SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001822 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001822
Domain Number 1 Region: 47-163
Classification Level Classification E-value
Superfamily FKBP-like 1.05e-34
Family FKBP immunophilin/proline isomerase 0.000000426
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily WW domain 0.000000000000935
Family WW domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001822   Gene: ENSMICG00000001996   Transcript: ENSMICT00000001994
Sequence length 163
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4497:11643:22318:1 gene:ENSMICG00000001996 transcript:ENSMICT00000001994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSTSSGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Download sequence
Identical sequences XP_012646140.1.48125 ENSMICP00000001822 ENSMICP00000001822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]