SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001911 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001911
Domain Number 1 Region: 19-169
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 2.35e-81
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000635
Further Details:      
 
Domain Number 2 Region: 174-208
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.00000000173
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001911   Gene: ENSMICG00000002087   Transcript: ENSMICT00000002089
Sequence length 425
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2462:308012:318195:-1 gene:ENSMICG00000002087 transcript:ENSMICT00000002089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LACGPGRGGKRHPKKLTPAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDI
IFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGR
AVDITTSDRDRSKYGMLAPLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSAT
VHLEQGGTKLVKDLRPGDRVLAADDKRLLYDLTFRDTNKNVIDLTKMGXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXGGVNGGDDGGGRLSPIDTGEPDGPGAAGVWYSQVLYRIGTWLLDREALHPLGM
AVASN
Download sequence
Identical sequences ENSMICP00000001911 ENSMICP00000001911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]