SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001913 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001913
Domain Number 1 Region: 266-426
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-33
Family Kelch motif 0.00079
Further Details:      
 
Domain Number 2 Region: 10-65
Classification Level Classification E-value
Superfamily POZ domain 0.00000000369
Family BTB/POZ domain 0.0064
Further Details:      
 
Domain Number 3 Region: 497-557
Classification Level Classification E-value
Superfamily Kelch motif 0.000000549
Family Kelch motif 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001913   Gene: ENSMICG00000002092   Transcript: ENSMICT00000002092
Sequence length 576
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3395:3309:14808:1 gene:ENSMICG00000002092 transcript:ENSMICT00000002092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCHVDDLDFHLPSHAQDMLDGLQRLRSQRKLADVTLLGGRELPCHRLLALSSPYFHAMF
TGSFAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVRPALPQKLEEVLVVVGGRALEEDEGGEEPSAHPGNFAFYNTKA
KKWMALPDFPDYHKWGFSLAALNNDIYVTGGSRGTKTDTWSTTQAWCFPLKEAAWRPVAP
MLKARTNHASAALNGEIYAIGGTTLDVVEVESYDPYTDSWTPVSPALKYVSNFSAAGCRG
RLYLVGSSACKYNALALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXVQSLHSLHENGALVPLGDALYVTGGRWQGMDGDYHVEMEAYDAVRDT
WTRHGALPRLWLYHGASAVFLEVSKWTQPFHPAQEH
Download sequence
Identical sequences ENSMICP00000001913 ENSMICP00000001913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]