SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002132 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002132
Domain Number 1 Region: 105-178
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.35e-18
Family Ribosomal protein L11, C-terminal domain 0.0047
Further Details:      
 
Domain Number 2 Region: 28-116
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.000000000000549
Family Ribosomal L11/L12e N-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002132   Gene: ENSMICG00000002326   Transcript: ENSMICT00000002332
Sequence length 227
Comment pep:novel genescaffold:micMur1:GeneScaffold_3425:643980:648344:-1 gene:ENSMICG00000002326 transcript:ENSMICT00000002332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFRFSARRRPRCNFLRSSRIRVHPTPAASTMPPKFDPNEIKVVYLRCTGGEVGATSALAP
KIGPLGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEVVPSASALIIKALKEPPR
DRKKQKNIKHNGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHD
IIDDINSGAVECPAVSNSCTSFIVVIGVKGEVPNVEISVIEVVSGLG
Download sequence
Identical sequences ENSMICP00000002132 ENSMICP00000002132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]