SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002165 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002165
Domain Number 1 Region: 27-124
Classification Level Classification E-value
Superfamily AlbA-like 4.32e-20
Family DNA-binding protein AlbA 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002165   Gene: ENSMICG00000002373   Transcript: ENSMICT00000002369
Sequence length 163
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3210:378479:378970:-1 gene:ENSMICG00000002373 transcript:ENSMICT00000002369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLESGSARHVVFSGS
GRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPTAPDTGLDPLTVRRHVPAVWVL
LSRDPLDPNECGYQPPGAPPGLGSVPSSSCGTRPRRRARDTRS
Download sequence
Identical sequences ENSMICP00000002165 ENSMICP00000002165 XP_012625565.1.48125 XP_012625566.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]