SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002356 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002356
Domain Number 1 Region: 452-556,678-794
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.04e-55
Family Phosphate binding protein-like 0.0000000122
Further Details:      
 
Domain Number 2 Region: 77-284
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.66e-17
Family L-arabinose binding protein-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002356   Gene: ENSMICG00000002577   Transcript: ENSMICT00000002579
Sequence length 1456
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4027:427833:780565:-1 gene:ENSMICG00000002577 transcript:ENSMICT00000002579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPGYWTLLVLQTLLVWRGPAQGAAAEKGPPALNIAVLLGHSHDVTERELRTLWGPEQG
AGLPLDVNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQT
FVPILGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFTLVTTIFPGY
RDFISFVKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGIGILT
TAASSMLERFSYIPEAKTSCYGQAEKPEVPGHTLHXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRKFVKINNSTNEMMKCCKGFCIDILKKLSRTVKFTYDLYLVTNG
KHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGT
VSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGK
AIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVT
GLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKYNQKGVEDALVSLKTG
KLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRPIDLALLQFV
GDGEMEELETLWLTGICHNEKNEVMSSQLDVDNMAGVFYMLAAAMALSLITFIWEHLFYW
KLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKSPDFNLTGSQSNMLKLLRSAKNI
SNVNSSRIDSPKRSADFIQRGSLTMDMVSDKGNLIYADNRSFQGKDSIFGDNMNELQTFV
ANRHKDALNNYVFQGQHPLTLNESNPNTVEVAVSTESKGSSRSRQLWKKSMDSIRQDSLT
QNPVSQRDEGTMENRTHSLKSPRYLPEEVAHSDISETSSRATCHREPDNNKNHKTKDNFK
RSMASXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGEKEPSFHLDPPQYVENMTLPENVDF
PDTYQDHNKNFHKGDSTLPATRNPLHNGDGLPNNDQYKLYSKHFTLKDKGSPLSEGSDRC
QRNSTHCRSCLSNLPTYAGHFTMRSPFKCDACLRLGNLYDIDEDQMLQETGNPATRESYQ
QDWAQNNTLQFQKNKLRISRQHSYDNIVDKPRETDLSRPSRSISLKDRERLLEGNSYGSL
FSVPASKLLGNKSSLFPQGLEDSKRSKSLLPDHTSNNPFLHSHRHDQRLVIGRCPSDPYK
HSLPPQAVNDSYLQSSLRSTASYCSRDSRGHSDVYMSEHVMPYAANKNNMYSTPRVLNSC
SNRRVYKKMPSIESDV
Download sequence
Identical sequences ENSMICP00000002356 ENSMICP00000002356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]