SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002427 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002427
Domain Number 1 Region: 157-454
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 2.48e-74
Family 2-methylcitrate dehydratase PrpD 0.0049
Further Details:      
 
Domain Number 2 Region: 4-89
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0000000000000275
Family 2-methylcitrate dehydratase PrpD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002427   Gene: ENSMICG00000002667   Transcript: ENSMICT00000002665
Sequence length 482
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3844:511945:521223:1 gene:ENSMICG00000002667 transcript:ENSMICT00000002665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMLKSVTESFAKVIHGLKVGHLTDQVIQRSKRMILDTLGVGFLGTSTDVFHKASQYSKIY
SSNISSTVWGQPDFRLPPTYAAFVNGVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHPPSVVGTLGSAAAASKFLGLS
LTKCQEALAIAVSYAGAPMANAATETKPLHIGNAAKHGIEAAFLAMLGLQGNKQALDLEA
GFGAFYANYSPKVLPNLDSHTWLLDQQDVAIKSFPAHLATHWVADAAASVRKHLVTETAL
FPTEHIKRVVLRIPKVQYVNRPFPDSEHEARHSFQYVACAMLLDGDITVSSFQKHQINRP
QVRELLSKVELEHPPDNLPSFNTLYCEISVTLKDGTTFTHRSDTFYGHWRKPLNQKDLEA
KFRANASTTLSCDTVESLIKIVEKLEDLEDCSVLTTLLKGSSTPEAASNYPAYNNSITSL
SW
Download sequence
Identical sequences ENSMICP00000002427 ENSMICP00000002427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]