SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002472 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002472
Domain Number 1 Region: 19-235
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.99e-74
Family Phosphate binding protein-like 0.00000426
Further Details:      
 
Domain Number 2 Region: 237-295,329-351
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.96e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002472   Gene: ENSMICG00000002715   Transcript: ENSMICT00000002714
Sequence length 359
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4181:214936:222701:1 gene:ENSMICG00000002715 transcript:ENSMICT00000002714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKGDAAATAEKNSPKMRVIRVGTRKSQLARIQTDTVVAMLKALYPGLQFEIIAMSTTG
DKILDTALSKIGEKSLFTKELEHALERNEVDLVVHSLKDLPTVLPPGFTIGAIRENPCDA
VVFHPKFVGKTLETLPERSVVGTSSLRRAAQLKRRFPHLEFKNIRGNLNTRLRKLDELQE
FSAIILATAGLQRMGWQNRVGQILHPEECLYAVGQGALGVEVRAKDQDILDLVGVLHDPE
TLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSMQETMQATIHVP
AQHEDGPEDDPQLVGITARNIPRGAQLAAENLGISLARLLLNKGAKNILDVARQLNDAH
Download sequence
Identical sequences ENSMICP00000002472 ENSMICP00000002472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]