SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002516 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002516
Domain Number 1 Region: 157-334
Classification Level Classification E-value
Superfamily E set domains 3.03e-56
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000322
Further Details:      
 
Domain Number 2 Region: 55-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-21
Family Voltage-gated potassium channels 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002516   Gene: ENSMICG00000002768   Transcript: ENSMICT00000002764
Sequence length 337
Comment pep:known_by_projection scaffold:micMur1:scaffold_622:134935:135949:1 gene:ENSMICG00000002768 transcript:ENSMICT00000002764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYYGSSYRIVNVDSKYPGYPPEHVIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWLIAFHHGDLLNDPDITPCVDNVHSFTA
AFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
PREILWGHRFHDVLEVKRKYYKVNCLQFEGSVEVYAC
Download sequence
Identical sequences ENSMICP00000002516 ENSMICP00000002516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]