SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002610 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000002610
Domain Number - Region: 398-481
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0384
Family PYP-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002610   Gene: ENSMICG00000002868   Transcript: ENSMICT00000002866
Sequence length 832
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4119:342224:550751:-1 gene:ENSMICG00000002868 transcript:ENSMICT00000002866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPHPPSPLITLEAQHGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPE
LAKKPPSRQKELLKRKLEQQEKGKGPSEALPPSERAAANSSRGKDAPRQPHARKGGGSSP
ETRYDQPPKCDISGKEAVSALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRFCPLDGKA
NKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYL
HRQVLQFSRQYGNVRITPWRMATIWGGASLLSTYLQSMRDLLEMTDWXXXXXXXXXXXXX
XXXTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGI
AVDGGSDWFLLNRKFVEYVTFSTDDLVAKMKQFYTYTLLPAESFFHTVLENSPHCDTMVD
NNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQE
IIGQLDYYLYGNYPAGTPGLRSYWENVYDEPDGVHSLSDVALTLYHSFARLGLRRAETSL
HTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKI
ASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTVTVIWVDP
VNVIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNR
QPIKPEEALKLHNGPPRSAYMEQSFQSLNPVLSLPISPAQVEQARRNAASTGAALEGWLD
SLVGGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
Download sequence
Identical sequences ENSMICP00000002610 ENSMICP00000002610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]