SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002646 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002646
Domain Number 1 Region: 32-141
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.09e-36
Family Frataxin-like 0.000000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002646   Gene: ENSMICG00000002905   Transcript: ENSMICT00000002904
Sequence length 154
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3213:15481:34134:1 gene:ENSMICG00000002905 transcript:ENSMICT00000002904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLNLHCLNQFLNVKKQSVCLMNLRKSGTLGDPSSLDETTYERLAEETLDSLAEFFEDLAD
KPYTFEDYDVSFGSGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSGPKRYDWTGKNWVYS
HDGVSLHELLAAELTAALKTKLDLSSLAYSGKGT
Download sequence
Identical sequences ENSMICP00000002646 ENSMICP00000002646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]