SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002683 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002683
Domain Number 1 Region: 244-342
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.42e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000237
Further Details:      
 
Domain Number 2 Region: 95-203
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000103
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 11-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000174
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002683   Gene: ENSMICG00000002949   Transcript: ENSMICT00000002946
Sequence length 869
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1318:61332:150543:1 gene:ENSMICG00000002949 transcript:ENSMICT00000002946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTQKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYDNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSEHMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCVMCVNYXXXEIEKNDVVFSMDQTE
SLFKPHLMSMNSIFDSSGDVAVSDKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGCQN
FEESSAYGKAILPPSQPWGAEVRSHSTQSEAGSLPAFTVPQAAAAGSTTPSATSNSSCST
PSSPGDYYSSLDDNLKIEVIEKLFAMDTEAKDQCSTQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSAKGYGSRGPDVMSPAMVALSNKLKLKRQLEYEEQAFQD
MSGVDPPGSSTSHLMWKRMKNLRGGSCPLMPDKPLNTNVPNDEFPQNPMRGLDQPLRHLP
PPQPPSTMSPGENAKSGFPLPCYATQYQDYGLPPAHKVSGIASRLLGPSFEPYLLPELTR
YDCEVNVPVPGSSTLLQGGDLLRALDQAT
Download sequence
Identical sequences ENSMICP00000002683 ENSMICP00000002683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]