SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002727 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002727
Domain Number 1 Region: 122-218
Classification Level Classification E-value
Superfamily vWA-like 2.67e-24
Family Integrin A (or I) domain 0.00025
Further Details:      
 
Domain Number 2 Region: 591-667
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.11e-16
Family Integrin beta tail domain 0.0029
Further Details:      
 
Domain Number 3 Region: 23-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000152
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 4 Region: 380-422
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000272
Family Integrin domains 0.0021
Further Details:      
 
Domain Number 5 Region: 505-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Integrin beta EGF-like domains 0.0031
Further Details:      
 
Domain Number 6 Region: 549-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000243
Family Integrin beta EGF-like domains 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000002727
Domain Number - Region: 270-304
Classification Level Classification E-value
Superfamily vWA-like 0.00196
Family Integrin A (or I) domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002727   Gene: ENSMICG00000002984   Transcript: ENSMICT00000002996
Sequence length 738
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2929:8044:31203:-1 gene:ENSMICG00000002984 transcript:ENSMICT00000002996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGRCHPLLALAGLLCLGPALAEECTKYKVSTCRDCVESGPGCAWCQKLNFTGPGDPDSI
RCDTREQLLMRGCPTDDIMDPRSLAEPLKDRQGARKQLSPQQVTLYLRPGQAAAFNVTFR
RAKGYPVDLYYLMDLSYSMLDDLINVKKLGGDLLRALNEITESGQIGFGSLANKTFRHVL
KLTSNADQFQTEVGKQLISGNQDAPGGGLDAMMQVAACPXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYPSVGQLAHKLAESNIQPIFAVTKRMVK
TFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSLRVFXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXITFQVKVTATCIQEQTFVIRPLGFPDTVTVRVLPQCECQCQ
DQSQERSLCQGKGSLECGVCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXGVPHKLVLGRSCECAISTCERSAHQPCGGPKRGLCFCGKCRCLEGYDG
SACQCQRTTEGCLNQRKVECSGRGRCSCNQCVCQNGYQPPLCLECPTCTSPCSDHSSCAE
CLRFDKGPLEKNCSAECRNLRLLEVPAQSGRTCKERDSEGCWMTYTLWQQDGWDRYDIHV
EESRECKASAAAIVGGIVAGIVLIGVLLLVIGKPVTHLSDLREYKRFEKEKLKSPGNNDN
PLFKSATTTVMNPKFAES
Download sequence
Identical sequences ENSMICP00000002727 ENSMICP00000002727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]