SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002824 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002824
Domain Number 1 Region: 22-293,347-386
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.33e-43
Family L-arabinose binding protein-like 0.0063
Further Details:      
 
Domain Number 2 Region: 424-529,649-684
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.25e-35
Family Phosphate binding protein-like 0.00000135
Further Details:      
 
Domain Number 3 Region: 544-646
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000298
Family Voltage-gated potassium channels 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000002824
Domain Number - Region: 768-795
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0804
Family Phosphate binding protein-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002824   Gene: ENSMICG00000003112   Transcript: ENSMICT00000003113
Sequence length 902
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2662:5513:393300:1 gene:ENSMICG00000003112 transcript:ENSMICT00000003113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCELERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHAGTAIRQSSGLAVIASD
LP
Download sequence
Identical sequences ENSMICP00000002824 ENSMICP00000002824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]