SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002830 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002830
Domain Number 1 Region: 18-117
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 3.82e-24
Family 4'-Phosphopantetheinyl transferase SFP 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002830   Gene: ENSMICG00000003121   Transcript: ENSMICT00000003119
Sequence length 306
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2662:480000:496196:1 gene:ENSMICG00000003121 transcript:ENSMICT00000003119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPAKRLCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAA
MAGRLMIRKLVAEKLNIPWNNIRLQRTAKGKPVLAKDSLNPYPNFNFNISHQGDFAVLAA
EPELQVGIDIMKTSFPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESKIDEHFA
VALRKPDGSRHQEVPSQDDSKPSQRKFTILTFNDIASAVPMTPEDPSFWDCFCFTEEILI
RNGTKS
Download sequence
Identical sequences ENSMICP00000002830 ENSMICP00000002830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]