SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002939 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002939
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 4.24e-23
Family BTB/POZ domain 0.0025
Further Details:      
 
Domain Number 2 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000014
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 310-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000115
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002939   Gene: ENSMICG00000003244   Transcript: ENSMICT00000003239
Sequence length 424
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_89:108246:109520:-1 gene:ENSMICG00000003244 transcript:ENSMICT00000003239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESDVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYINDTEFQGHKVILAACSTFMRD
QFLLTQSKHVRITILQSAEVGRKLLLSCYTGALEVKRKELLKYLTAASYLQMVHIVEKCT
EALSKYLEIDLSMKNNNQHTDLCQSSDPDVKNEEENSDKDCEIIEILEDSPVNIDFHVKE
EESNALQSTVENLTSERKEMKSPELSTIDIGFKDNEICILHVESISTAGVENGQFSQPCT
SSKASMYFSETQHSLINSTVESRVTEVPGNQGQGIFSENTEGSYGTVNEIQNLEESYSLR
HQCPRCPRGFLHVENYLRHLKMHKLFLCLQCGKTFTQKKNLNRHIRGHMGIRPFQCTVCL
KTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSGEKLSRPDLKR
QNLL
Download sequence
Identical sequences XP_012627299.1.48125 XP_012627300.1.48125 ENSMICP00000002939 ENSMICP00000002939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]