SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002995 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002995
Domain Number 1 Region: 288-426
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.07e-26
Family C-terminal domain of adrenodoxin reductase-like 0.000000429
Further Details:      
 
Domain Number 2 Region: 7-149
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 3.03e-21
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.0000004
Further Details:      
 
Domain Number 3 Region: 906-999
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3e-16
Family Ferredoxin domains from multidomain proteins 0.0000112
Further Details:      
 
Domain Number 4 Region: 755-838
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.76e-16
Family FMN-linked oxidoreductases 0.0000139
Further Details:      
 
Domain Number 5 Region: 407-493
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000903
Family N-terminal domain of adrenodoxin reductase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002995   Gene: ENSMICG00000003295   Transcript: ENSMICT00000003298
Sequence length 1012
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4297:43407:792924:-1 gene:ENSMICG00000003295 transcript:ENSMICT00000003298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SILALNPRTQSHAILRSTSAKKVDKKHWKRNPDKNCFNCEKLENNFDDIKHTTLGERGAL
REAMRCLKCADAPCQKSXXXXXXXXXXXXXXXXXNYYGAAKMIFSDNPLGLTCGMVCPTS
DLCVGGCNLYATEEGPINIGGLQQFATEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPEPNKDYIFEGLTQDQGFYTSKDFLPLV
AKGSKAGMCACHSPLPSIRGTVIVLGAGDTAFDCATSALRCGARRVFIVFRKGFVNIRAV
PEEMELAKEEKCEFLPFLSPRKVIVKGGRIVAMQFVRTEQDETGNWNEDEDQIVRLKADV
VISAFGSVLSDPKVKEALSPIKLNRWNLPEVNPETMQTSEPWVFAGGDIVGMANTTVESV
NDGKQASWHIHKYIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXILIASIMCSYNKNDWMELSKKAEXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAIRPIALRAVTSIARALPGFPILAT
GGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYLKSIEELQDWDGQS
PATVSHQKGKPVPRIPELVGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXEVIGKALQYLGTFGELSNVEQVVAMIDEEMCINCGKCYMTCNDSGYQAIQF
HPETHLPTITDACTGCTLCLSVCPIIDCIKMVSRTTPYEPKRGLPLAVNPVC
Download sequence
Identical sequences ENSMICP00000002995 ENSMICP00000002995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]