SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003005 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003005
Domain Number 1 Region: 3-253
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.78e-85
Family Eukaryotic proteases 0.0000000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003005   Gene: ENSMICG00000003309   Transcript: ENSMICT00000003308
Sequence length 254
Comment pep:known_by_projection scaffold:micMur1:scaffold_18377:637:6045:1 gene:ENSMICG00000003309 transcript:ENSMICT00000003308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSCGVPSIQPNLTARVVGGDSAEPHSWPWQISLQYLKDGTWRHTCGGTLIASNFVLTAAH
CINNALTYRVGLGKNNLAVEDEPGSLFVAVDTIHVHEKWNSFLVRNDIALIKLAEHVEMS
DTIQVACLPEEGSLLPQDYPCYVTGWGRLWTNGPISDELQQGLQPVVDHATCTQRDWWGS
MVKDTMVCAGGDGVISACNGDSGGPLNRQAENGSWEVVGIVSFGSGLGCNTLKKPTVFTR
VSVYIDWINQKMQL
Download sequence
Identical sequences ENSMICP00000003005 ENSMICP00000003005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]