SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003230 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003230
Domain Number 1 Region: 20-388
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.76e-56
Family L-arabinose binding protein-like 0.0061
Further Details:      
 
Domain Number 2 Region: 390-541
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.02e-32
Family Phosphate binding protein-like 0.00000269
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000003230
Domain Number - Region: 758-787
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0478
Family Phosphate binding protein-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003230   Gene: ENSMICG00000003547   Transcript: ENSMICT00000003549
Sequence length 907
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2774:103157:447318:1 gene:ENSMICG00000003547 transcript:ENSMICT00000003549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSVNEAIRTSTLPRNSGAGASGSGGSGENGRVVSHDFPKSMQSIPCMSHSSGM
PLGATGL
Download sequence
Identical sequences ENSMICP00000003230 ENSMICP00000003230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]