SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003250 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003250
Domain Number 1 Region: 1-159
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.09e-54
Family Carbonic anhydrase 0.0000009
Further Details:      
 
Domain Number 2 Region: 210-248
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.00000667
Family Carbonic anhydrase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003250   Gene: ENSMICG00000003574   Transcript: ENSMICT00000003571
Sequence length 249
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1889:168983:201454:1 gene:ENSMICG00000003574 transcript:ENSMICT00000003571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVHWNEFFPIADGDQQSPIEIKTKEAKYDSSLRPLSIKYDPSSAKIISNSGHSFSVDFDD
TEDKSVLRGGPLTGSYRLRQFHLHWGCADDHGSEHTVDGMKYAAELHVVHWNSDKYPSFV
EAAHEPDGLAVLGIFLQIGEHNSQLQKITDILDSIKEKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAKFRSLLCTAEGETAAFLLSNHRPPQPLK
GRKVRASFR
Download sequence
Identical sequences ENSMICP00000003250 ENSMICP00000003250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]