SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003383 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003383
Domain Number 1 Region: 25-191,456-589
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.31e-34
Family Quinoprotein alcohol dehydrogenase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003383   Gene: ENSMICG00000003702   Transcript: ENSMICT00000003713
Sequence length 1079
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3293:307593:507029:-1 gene:ENSMICG00000003702 transcript:ENSMICT00000003713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPSLQAVALWGKRAPPHSITAIMITDDQQMIVTGSQEGQLCLWNLSPELKISAKELLFG
HSASVTCLARARDFSKQPYVVSAAENGEMCVWNVTNGQCVEKATLPYRHAAICYYHCSFR
MTGEGWLLCCGEYQDVLIIDAKTLAVVHTFTSSQSPDWVNCMCIVHSMRIQEDSLLVVSV
AGELKVWDLSSSINSIQEKQDVYEKESKFLESLNCQTIRFCTYTERLLLVVFSKCWKVYD
YCDFSLLLTEVSRNGQFFDGGEVIGAHRILIWTEDGHSYIYQLLNSGLSKSIYPADGRVL
KETIYPHLLCSTSVQENKKQRHPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVS
KFDGSPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXDGTIIITQALNAAKAGLLEGGSLLKDSSPHKVLKGHHQSVTSLLYPHSLSSKLDQS
WMVSGDRDSCVIWWNIFTEEILHKFFLEAGPVTSLLMSPEKFRLRGDQIICCVCSDHSVG
LLHLEGKRCLLRARKHLFPVRMIKWHPVENFLIVGCADDSVYIWEIETXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEILRRAKSTV
EKKTMTLKKNKLSAEAQAKPASESLAQGDSANKFSEENNGIKRQKKMKSSKKMHPEPSRR
VDANLTIDTAKLFLSCLLPWGVDKELDHLCIKHLNILKLQGPVSLGLASNEDHFSLMLPG
WDLCNTETKRDDSRVNLFSGKVLELSNKYIATLSNQLAIPRGLENKCNSLQELNTIIYLL
SRLFLVNKLVNMPIDLTCGTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNGSHVP
EADLSLLKLISCWRDQSVQVTEAIQAVLLAEVQQHMKTLRKTPINSQPVSLAENGNCEMM
QNVPKMEWAEELELQCIRSTLPPQXXXXXXXXXXXXXXXXXXXAEDMPDRCVLEESESP
Download sequence
Identical sequences ENSMICP00000003383 ENSMICP00000003383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]