SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003418 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003418
Domain Number 1 Region: 220-300
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000314
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0071
Further Details:      
 
Domain Number 2 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000628
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000003418
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0048
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 
Domain Number - Region: 450-557
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0144
Family Apolipoprotein 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003418   Gene: ENSMICG00000003754   Transcript: ENSMICT00000003751
Sequence length 803
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3694:49621:54784:1 gene:ENSMICG00000003754 transcript:ENSMICT00000003751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLEGPTGLLSAEELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLALPSALDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSRHAKDLVLLDVSESVLIYL
GFERSELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEMVVRLQAKPGGWAWIYCLL
YSEGPEGPITANNYPISDTEAWSLRQQLNSEDTQAAYVLGTPTMLPSFPENVLSQEQCSS
ANPLFTPALGAPRSTSFPSAPELGIVSASEEIPRPPKQIDFSYLAFPSGPEPSFQADLSK
DLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPTPSSSLQEQLTPSTATFSDQLTPSSATFP
DPLTSPLQENVTETSPRIYEDQLTPCTSTFQYHLLPSTATFPEPLGSPAREQLTPPSTKF
QAHLNSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPL
SVDVPLVPEGLLTPEASPVKQSFFHYSEKEQNEIDRLIRQISQLAQGMDRPFSAEAGTGG
LEPLGGLEPLDSNLSLPGAGPPVLSLDLKPWKCQELDFLADPDVFLEETPVEDIFMDLST
PDPSEEWGSGGPEAEGPGGPPSPCNNLSPEDHSFLEDLATYETAFETGVSAFPYDGFTDE
LHQLQSQVQDSFHEDGSGGEPTF
Download sequence
Identical sequences ENSMICP00000003418 ENSMICP00000003418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]