SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003421 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003421
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.35e-23
Family Ribosomal L11/L12e N-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.36e-18
Family Ribosomal protein L11, C-terminal domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003421   Gene: ENSMICG00000003759   Transcript: ENSMICT00000003754
Sequence length 192
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3694:65244:67931:-1 gene:ENSMICG00000003759 transcript:ENSMICT00000003754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRATRAVRKLEPGGVIRTIVRAGQAMAGPPLGPILGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARHTGREVAGLVTLKHVYEI
ARIKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQRERATFLAAQKE
ADLAAQAEAAKK
Download sequence
Identical sequences ENSMICP00000003421 ENSMICP00000003421 XP_012613176.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]