SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003453 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003453
Domain Number 1 Region: 462-660
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.57e-65
Family Hemopexin-like domain 0.00000000331
Further Details:      
 
Domain Number 2 Region: 114-218
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.6e-33
Family Matrix metalloproteases, catalytic domain 0.00000123
Further Details:      
 
Domain Number 3 Region: 277-334
Classification Level Classification E-value
Superfamily Kringle-like 9.71e-22
Family Fibronectin type II module 0.0000628
Further Details:      
 
Domain Number 4 Region: 337-393
Classification Level Classification E-value
Superfamily Kringle-like 7.71e-21
Family Fibronectin type II module 0.0000864
Further Details:      
 
Domain Number 5 Region: 221-276
Classification Level Classification E-value
Superfamily Kringle-like 5.71e-20
Family Fibronectin type II module 0.0000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003453   Gene: ENSMICG00000003792   Transcript: ENSMICT00000003788
Sequence length 660
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2903:269279:298329:1 gene:ENSMICG00000003792 transcript:ENSMICT00000003788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARAARGALAGPLRALCVLSCLLGRAAAAPSPIIKFPGDVAPKTDKELAVXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDVANYTSSPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFD
GKEYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCSTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGKKY
DSCTSAGRSDGKMWCSTSASYDDDRKWGFCPDQXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXASPDTEAGTGPTPTLGPVTPELCKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRNKPMGPLLVATFWPELPERIDAVYEAPQEEKAVFFAGNEY
WVYSASTLERGYPKPLTSLGLPADLQWVDAAFNWSKNKKTYIFAGNKFWRYNEVKKKMDP
GFPKLIADAWNAVPDNLDAIVDLQGSGHSYFFYDMYYLKLENQSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences ENSMICP00000003453 ENSMICP00000003453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]