SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003487 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003487
Domain Number 1 Region: 42-174
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.76e-37
Family Methylmalonyl-CoA epimerase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003487   Gene: ENSMICG00000003827   Transcript: ENSMICT00000003823
Sequence length 175
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_166:36366:51332:-1 gene:ENSMICG00000003827 transcript:ENSMICT00000003823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYVQKAAALATGLFSRLQSPVPTLRAFFTSQPLHQVADPVWNLGRLNHVAIAVPDLEKA
ATFYKNVLGARVSEAVPLPEHGVSVVFVNLGNTKIELLHPLGSDSPIAGFLQKNKTGGMH
HICIEVNNINAAVMDLKKKNVRCLSEEAKIGAHGKPVIFLHPKDCGGVLVELEQA
Download sequence
Identical sequences ENSMICP00000003487 ENSMICP00000003487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]