SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003540 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003540
Domain Number 1 Region: 43-113
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000000000106
Family Ribosomal protein L11, C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.0000000000484
Family Ribosomal L11/L12e N-terminal domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003540   Gene: ENSMICG00000003884   Transcript: ENSMICT00000003880
Sequence length 132
Comment pep:novel scaffold:micMur1:scaffold_175819:130:631:1 gene:ENSMICG00000003884 transcript:ENSMICT00000003880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKFDPNAIKVMYLRCTGGEVSAVSALAPKISPLGLLIEVVPSASALIIKALKEPLGDR
KKQKNIKHNRNITFHKIVNTARQMWHPSLARELSKTIKYILGTASVGCNIDGHHLHAIID
DINSGAVACPAS
Download sequence
Identical sequences ENSMICP00000003540 ENSMICP00000003540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]