SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003577 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003577
Domain Number 1 Region: 110-361
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 5.3e-76
Family Glutamine synthetase catalytic domain 0.0021
Further Details:      
 
Domain Number 2 Region: 20-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 2.09e-21
Family Glutamine synthetase, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003577   Gene: ENSMICG00000003925   Transcript: ENSMICT00000003922
Sequence length 371
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1985:105317:110401:-1 gene:ENSMICG00000003925 transcript:ENSMICT00000003922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSASSQLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKSVEELPEW
NFDGSSTLQSEGSNSDMYLMPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRI
MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFWPQGPYYCGVGADRAYGRDIVEAHYR
ACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPK
PIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIERLSKRHQYHIRAYDPKGGLDNARRLT
GFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLL
NETGDEPFQYN
Download sequence
Identical sequences ENSMICP00000003577 ENSMICP00000003577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]