SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003608 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003608
Domain Number 1 Region: 39-144
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.4e-28
Family Alanine racemase-like, N-terminal domain 0.0000228
Further Details:      
 
Domain Number 2 Region: 303-385
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.93e-19
Family Eukaryotic ODC-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003608   Gene: ENSMICG00000003961   Transcript: ENSMICT00000003960
Sequence length 392
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4474:114168:130982:-1 gene:ENSMICG00000003961 transcript:ENSMICT00000003960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVDCDETNLGNVDYVYEHTTGKNAFFVGDLGKIVKKHSQWQNVVAQIKPF
YTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIYISPCKQVSQIKYAAK
VGVNIMTCDNEIELKKIARNHPNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKT
GSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKVTKYKKDEPLFISSLWGPSCDELDQ
IVESCLLPELNVGDWLIFENMGADSFHEPSAF
Download sequence
Identical sequences ENSMICP00000003608 ENSMICP00000003608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]