SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003847 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000003847
Domain Number - Region: 138-231
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00479
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003847   Gene: ENSMICG00000004218   Transcript: ENSMICT00000004220
Sequence length 408
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_995:25172:108883:1 gene:ENSMICG00000004218 transcript:ENSMICT00000004220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRLRKLRATLDEYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLES
ALAEHAPAPQEVNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESC
KPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQT
QATTTHSIAHLVPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYS
AVADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSE
AAHAVATAELQGEGQIVSGETAAAVGALTGVQDANGLSMADQAGCKWILTDKARGLVQIP
VSMYQTVVTSLAQGNGPVQVAMAPVTTRISDSAVTMDGQAVEVVTLEQ
Download sequence
Identical sequences ENSMICP00000003847 ENSMICP00000003847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]