SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004291 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004291
Domain Number 1 Region: 46-185
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 1.7e-45
Family Molybdopterin synthase subunit MoaE 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004291   Gene: ENSMICG00000004714   Transcript: ENSMICT00000004709
Sequence length 189
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2668:444731:452079:-1 gene:ENSMICG00000004714 transcript:ENSMICT00000004709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISSSCFNQEMKLPLSPPLVEASAFEPSRREMDEVGEKPKEIIKFTAKKLSVDEVS
QFVISPLCGAVSLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICGEIRQKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLEAVNYAIDNLKAKVPIWKKEMYEESSSSWKRN
KECFWATND
Download sequence
Identical sequences ENSMICP00000004291 XP_012595869.1.48125 ENSMICP00000004291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]