SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004302 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004302
Domain Number 1 Region: 10-146
Classification Level Classification E-value
Superfamily MAPEG domain-like 8.24e-43
Family MAPEG domain 0.000000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004302   Gene: ENSMICG00000004723   Transcript: ENSMICT00000004720
Sequence length 155
Comment pep:known_by_projection scaffold:micMur1:scaffold_5113:51939:60607:1 gene:ENSMICG00000004723 transcript:ENSMICT00000004720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLTQLMENEVFMAFASYATIILSKMMFMSTATAFYRLTRKVFANPEDCAGFGKGENAK
KYLRTDDRVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALLHFRLFVGARIYHTIA
YLTPLPQPNRALGFFVGYGVTFSMAYSLLRNKLYL
Download sequence
Identical sequences ENSMICP00000004302 ENSMICP00000004302 XP_012631281.1.48125 XP_012631282.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]