SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004304 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004304
Domain Number 1 Region: 334-432
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000004304
Domain Number - Region: 188-240
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0483
Family N-terminal PAS domain of Pas kinase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004304   Gene: ENSMICG00000004716   Transcript: ENSMICT00000004722
Sequence length 1260
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1836:3578:33621:-1 gene:ENSMICG00000004716 transcript:ENSMICT00000004722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYAEFPSRPSDPTRGPPEPQPGRAPLQDDVDMSSGSSGNETSENCSTGRDSRGSDCGD
SGKEQGMLVEPPAAHQSPDAFSLMMAKSEHNPSTSGCSSDQPAKADAHRELIQTLKELKG
HLPADKRAPGKASTLATLKYALSSVKQVRANEEYYQLLMSSESHPCGPDVPPCTVEDMER
VTSEYIGKNMDMFAVAVSLVTGKILYVSDQVASIFRCKRDAFSDAKFVEFLAPHDVSVFH
SFTTPCKLPAWGVCGRADSFAQECMEEKSFFCRVSVGKNHENEVRYHPFRMTPYLAKVRD
QRGEESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDIDERAVPLLGYLPQD
LTETPVLLQLHPSDRPLMLAVHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFVNP
WSRKIAFIIGRHKVRVGPLNEDVFTARPCEEEKAPSPGIQELTEQIHRLLLQPVPHSGSS
GYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRSETCKSGSKTKPKSRYSHEPGEQKEKS
VSEMQSSPPAQMKAVPAAEKGSSGAGFSKASSPEELACKSQPACSYQQISCLDSVIRYLE
SCSEAATLKRKCEFPANIPALRSSDKRKAMVGPGPPAREAVSPSNVNSHTAVSTRLTSLA
LPRKAESVVSLTSQCSYSSTIVHVGDKKPQPESEVVEDAVSGPDSLDCLAAPALPCGLGQ
EKGAFRKLGLTKEVLAAHTQKEEQSFLQKFREIRKLSIFQSHCHYYLQERSRGHLSERTA
SGLRNPSGIDSSWKKAGKSRKLKSKRVKHRDSSESTGXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVMDVQHQFAAQPPPF
PAPLAPVMAFVLPSYSFPLAPPSPPQAFFPGHPHCPGHPTLVSEMTPASQPELPGQTSIP
RQPYACPATPATPPSAAGRASPPLFQSRGSSPLQLNLLQLEEGPECGAGAVGAAGATGTA
ASGPDYNPGTSRDRQPKASPTRREPSDAQNSDALSTSSDLLNLLLNDDLCSASASAASDS
LGSSSLGLNASRAGGAGSSDTSHTSKYFGSVDSSENTHRAKPSTGVGESEHFIKYVLQDP
IWLLMADTDDSVMMTYQLPSRNAETVLKENREKLRLLQKFQPRFSEAERRELSEVHPWMR
TGGLPPALGAAECVYCENEGKGNICVPYEEDIPSLGHSEASDTKEEDSGSPLSHKNEEQT
Download sequence
Identical sequences ENSMICP00000004304 ENSMICP00000004304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]