SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004593 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004593
Domain Number 1 Region: 17-339
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1e-107
Family Aldose 1-epimerase (mutarotase) 0.000000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004593   Gene: ENSMICG00000005031   Transcript: ENSMICT00000005038
Sequence length 341
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2343:4794:60991:1 gene:ENSMICG00000005031 transcript:ENSMICT00000005038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSVTRAVFGELPAGAGTVEKFQLQSDLLRVDVISWGCTITALEVQDRQGRASDVALGFA
GLEGYLQNKPYFGAVVGRVVNRIAKGTFKIDGKEYHLAINREPNSLHGGVRGFDKVLWTP
QVLSNGIQFSRVSPDGEEGYPGELKVWVTYTLDGGELMVNYRAQTSKTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADTFLPVDENLIPTXXXXXXXXXXXXXXXXXXLGHLQAFHLNG
FDHNFCLKGSKEKHLCARVYHAGSGRVLEVYTTQPGVQFYTGNFLDGTLKGKSGAVYPKH
SGFCLETQNWPDAVNQPHFPSVLLRPGEEYNHTTWFKFSVA
Download sequence
Identical sequences ENSMICP00000004593 ENSMICP00000004593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]