SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004831 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004831
Domain Number 1 Region: 80-149
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.0000000000102
Family Translation initiation factor IF3, N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004831   Gene: ENSMICG00000005301   Transcript: ENSMICT00000005299
Sequence length 153
Comment pep:novel scaffold:micMur1:scaffold_17403:5519:5979:-1 gene:ENSMICG00000005301 transcript:ENSMICT00000005299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVFLNRLILQTVKTENNCIRRCFGKHIVQRTAPAQLSPAASAPRLSFLIHTKAFSTIQ
DIQDERKKKKKDGTAFSNTGRKISERIIHVLDEKGNDLGIMHRADVIRLLDERDLRLVQK
NPRAEPPQYQLMTGIQIHEERMRLREREKASET
Download sequence
Identical sequences ENSMICP00000004831 ENSMICP00000004831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]