SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005113 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005113
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.44e-47
Family Peptidyl-tRNA hydrolase-like 0.0000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005113   Gene: ENSMICG00000005611   Transcript: ENSMICT00000005606
Sequence length 189
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2047:117553:118999:-1 gene:ENSMICG00000005611 transcript:ENSMICT00000005606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKRWLVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWARDRRCAADLALAPLGDAQLV
LLRPRRLMNANGRSVARAAEMFGLTAEEVYLVHDELDKPLGKLALKLGGSARGHNGVRSC
ISCLNSSAMPRLRVGIGRPTNPEAVQAYVLGCFSPSEQELLPLLLDRATDLLLDHIRERS
QGTSAGVSP
Download sequence
Identical sequences ENSMICP00000005113 ENSMICP00000005113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]