SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005162 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005162
Domain Number 1 Region: 170-272
Classification Level Classification E-value
Superfamily DNA clamp 0.000000000000138
Family DNA polymerase processivity factor 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000005162
Domain Number - Region: 28-100
Classification Level Classification E-value
Superfamily DNA clamp 0.00722
Family DNA polymerase processivity factor 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005162   Gene: ENSMICG00000005664   Transcript: ENSMICT00000005659
Sequence length 281
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1229:988838:995031:-1 gene:ENSMICG00000005664 transcript:ENSMICT00000005659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQHIQDENDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQ
ANAFIQAGIFQEFTVQEESVTFRINLTVLLDCLSIFGSNPMPGTLTALRMCYQGYGYPLM
LFLEEGGVVTVCKINTQEPEETLDLGVSSHXXXXXXXXXXXXXXXXXXXLDMTSEVLQIT
MSNKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCKV
SIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESES
Download sequence
Identical sequences ENSMICP00000005162 ENSMICP00000005162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]