SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005170 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005170
Domain Number 1 Region: 81-185
Classification Level Classification E-value
Superfamily GlnB-like 1.82e-25
Family Divalent ion tolerance proteins CutA (CutA1) 0.00000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005170   Gene: ENSMICG00000005673   Transcript: ENSMICT00000005668
Sequence length 196
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4619:37915:39715:-1 gene:ENSMICG00000005673 transcript:ENSMICT00000005668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEPGLAGSGGSGSPASTVTWCVLFSHHVTTAQAALLLSCLWMPALLPVASRFLLLPRALL
SMASGSPPSQPSPASGSSYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQII
SXXXXXXXXXXXXXXXXMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNSLYLHWV
RQVTESVSDSSTVLPS
Download sequence
Identical sequences ENSMICP00000005170 ENSMICP00000005170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]