SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005260 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005260
Domain Number 1 Region: 342-595
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.28e-74
Family Aconitase iron-sulfur domain 0.0000000602
Further Details:      
 
Domain Number 2 Region: 38-138
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 3.92e-24
Family Aconitase iron-sulfur domain 0.00000897
Further Details:      
 
Domain Number 3 Region: 708-777
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 0.00000000000000373
Family LeuD-like 0.00017
Further Details:      
 
Domain Number 4 Region: 864-923
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 0.0000000000432
Family LeuD-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005260   Gene: ENSMICG00000005757   Transcript: ENSMICT00000005764
Sequence length 927
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2017:684:80372:1 gene:ENSMICG00000005757 transcript:ENSMICT00000005764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLPYSIRVLLEAAVRNCDDFLMKK
EDVMNILDWKTKQSNVEVPFFPARVLLQDFTGIPAMVDFAAMRDAVKILGGDPKKVHPAC
PTDLTVDHSLQIDFSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLRQVGVAGKFVEFFGSGV
SQLSIVDRTTIANMCPEYGAILSFFPVDNVTLKHLEHTXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVIQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIA
AEKQNDIVSIHYEGSQYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVEAGLRVKP
YIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFEIVGYGCSTCVGNTAPLSEAVLSAVKQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMGNKRWNSLEAPDSVLFPWDLKSTYIRC
PSFFDKLTKEPVALKPIENAHVLLYLGDSVTTDHISPAGSIARNSAAAKYLTNRGXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENAD
SLGLSGRETFSLTFPQELSPGITLNIQ
Download sequence
Identical sequences ENSMICP00000005260 ENSMICP00000005260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]