SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005363 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005363
Domain Number 1 Region: 151-234
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 233-287
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000293
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000005363
Domain Number - Region: 602-681
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0259
Family Tetraviridae-like VP 0.02
Further Details:      
 
Domain Number - Region: 393-420
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0723
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005363   Gene: ENSMICG00000005872   Transcript: ENSMICT00000005878
Sequence length 821
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2319:23854:139861:-1 gene:ENSMICG00000005872 transcript:ENSMICT00000005878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDSAVAVAAVTRRFWGVALLSPSPVRRQLLPGGWRGGGSIYGYGGDYCPRXXXXXXXXXX
XXXXXXXXXMTSDVPSLGPAIASGNPGSGIQGGGAIVQRAVKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXCGNSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPASPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXVSVQPVTATGPEHSKPLEKSDGLFAQDRDPRFSEIYSNINADQ
SKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQISRH
SNPTQGSASTWTPSTRPGFSAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXEMLSMLGDQSNSYNNEEFPDLTMFPSFSE
Download sequence
Identical sequences ENSMICP00000005363 ENSMICP00000005363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]