SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005452 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005452
Domain Number 1 Region: 932-1081
Classification Level Classification E-value
Superfamily C-type lectin-like 3.65e-40
Family C-type lectin domain 0.00045
Further Details:      
 
Domain Number 2 Region: 645-779
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-39
Family C-type lectin domain 0.000000147
Further Details:      
 
Domain Number 3 Region: 790-925
Classification Level Classification E-value
Superfamily C-type lectin-like 2.75e-37
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 4 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.99e-34
Family Cysteine rich domain 0.000000815
Further Details:      
 
Domain Number 5 Region: 499-638
Classification Level Classification E-value
Superfamily C-type lectin-like 1.25e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 6 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-19
Family Fibronectin type II module 0.00073
Further Details:      
 
Domain Number 7 Region: 230-267,414-469
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000219
Family C-type lectin domain 0.0037
Further Details:      
 
Domain Number 8 Region: 1305-1360
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000682
Family C-type lectin domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005452   Gene: ENSMICG00000005965   Transcript: ENSMICT00000005978
Sequence length 1449
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2039:155952:245753:1 gene:ENSMICG00000005965 transcript:ENSMICT00000005978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLALLLAFVSVIPGSVQLLDTRQFLIYNEDHKRCVEAVSPSAVQTAVCNQDSESQKFRW
VSESQIMSVAFKLCLGVPSKTDWVSVTLYACDLRSEFQKWECKNDTLFGIKGEDLFFNYG
NKQEKNIMLYKGSGLWSRWKIYGTTDDLCSRGYEAMYTLLGNANGATCAIPFKFENKWYA
DCTSAGRSDGWLWCGTTTDYDTDKLFGFCPLKFEGSESLWNKDPLTSIAYQINSKSALTW
QQARKSCQQQNAELLSITEIHEQTYLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPND
ELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKXXXXXXXXXXX
XXXXXXXXXXXXQAPGIVEVETGCRKGWKRHGFYCYLIGHTLSTFTEANETCKSEKAYLT
TVEDRYEQAFLTSLVGLRPERYFWTGLSDIQNKGTFQWTIEEDVQFTHWNSDMPGRKAGC
VAMKTGIAGGLWDVLKCDEKAKFVCKHWAEGVTRPPEPTTTPEPKCPEDWGTTSKTSLCF
KLFAKGKHEKKTWFESRDFCRALGGDLASINSKEEQQTIWRLITTSGSYHELFWLGLTYG
SPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIR
KGETPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQS
ESEKKFLWKYVNRNDAQEAYFIGLLISFDKKFAWMDGSKVDFVSWATGEPNFANEDENCV
TMYSNSGFWNDINCGYPNAFICQRHNSSINATAMPTTPSVPSGCKEGWKFYNNKCFKIFG
FAEEERKNWQEARKACMGFGGNLVSIQNEKEQAFLTYHMKDSTFNTWIGLNDVNSEHTFL
WTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGKSNEAGKWMDDTCDSKRGYICHT
RSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFWLWKNSNPASFVNCN
GRDPSGERKDCKVLYAASGVWNTIHCSSYKGYICKRPKIVDAEPTHTLITTKADSRKMDP
AKPSSNVAGAVVVVVLLILTGAGLAAYFYYKRRRVPLPQEGAFENTLYFNSQPSSGTSDT
KDLMHIEQN
Download sequence
Identical sequences ENSMICP00000005452 ENSMICP00000005452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]