SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005584 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005584
Domain Number 1 Region: 122-509
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-145
Family ALDH-like 0.00000000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005584   Gene: ENSMICG00000006105   Transcript: ENSMICT00000006125
Sequence length 514
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1693:65279:166527:-1 gene:ENSMICG00000006105 transcript:ENSMICT00000006125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSKIEMSGEMKADPAALIASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XTMESLNGGKPFLQAFYVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILP
GYGPTAGAAIASHVGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQG
PQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFP
QKLFKLWDEVIERANNSDFGLVAAVLTNDINKALTVSSAMQAGTVWINCYNALNAQSPFG
GFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences ENSMICP00000005584 ENSMICP00000005584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]