SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005779 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005779
Domain Number 1 Region: 17-127
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-25
Family PDZ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005779   Gene: ENSMICG00000006339   Transcript: ENSMICT00000006336
Sequence length 139
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_117:5:536:1 gene:ENSMICG00000006339 transcript:ENSMICT00000006336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCPLHHRSETLGTCSESPGVTQSKARHASKPSQTSGQLYVELVRGSTGFGLTLSGGGDVS
GDAPLAVPGLLKDGPAQRCGRLQVGDLVLPINGESTQNLTHAQAVERIRAGGPRLCLVLH
PPLKTHPGKPERVRSQKGG
Download sequence
Identical sequences ENSMICP00000005779 ENSMICP00000005779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]