SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005783 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005783
Domain Number 1 Region: 107-151
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 7.33e-19
Family AN1-like Zinc finger 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005783   Gene: ENSMICG00000006343   Transcript: ENSMICT00000006340
Sequence length 156
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_569:42088:53829:1 gene:ENSMICG00000006343 transcript:ENSMICT00000006340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSVSSLSEPLPAQCTDGSVPEARSAPDATPSSTQPSPVSNQSLLSESVASSQVDSTSVDK
AVPETEDLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFECRCGNVYCGV
HRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI
Download sequence
Identical sequences ENSMICP00000005783 ENSMICP00000005783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]