SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005862 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005862
Domain Number 1 Region: 147-265,300-436
Classification Level Classification E-value
Superfamily MFS general substrate transporter 9.42e-28
Family Glycerol-3-phosphate transporter 0.049
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000005862
Domain Number - Region: 39-73
Classification Level Classification E-value
Superfamily Kringle-like 0.0817
Family Kringle modules 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005862   Gene: ENSMICG00000006419   Transcript: ENSMICT00000006422
Sequence length 563
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2547:1178:18665:-1 gene:ENSMICG00000006419 transcript:ENSMICT00000006422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFSEILDRVGSMGPFQFLHVAILSIPILNMANHNLLQIFTAATPPHHCRPPPNASAGPW
VLPMGPNGKPERCLRFVHLPNASLPNDTQRATEPCLDGWVYNSTGDTIVTEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXFGRRPILTGSYLLLAASGSGAAFSPSLHSYFVFR
FLCGCGISGIVLSTIILNVEWVPTRMRALATTITGYFYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSXXXPESIRWPVKVLEGPEDTPAGGCPQWQEEGKRLSLEELKHNLQKE
MSLAKAKYSASDLFRTPMLRRVTFCLSLAWFATGFAYYGLAMGVEEFGVNLYILQVIFGG
VDIPAKFITVLSLSYVGRHTTERFPAPGRAILALTLVPLDMQILRTVLAVFGKGCLSSSF
SCLFLYTSELYPTVIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXKASQMIPLQPYEPSPLAAS
Download sequence
Identical sequences ENSMICP00000005862 ENSMICP00000005862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]