SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005922 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000005922
Domain Number - Region: 122-157
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0085
Family VPS37 C-terminal domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005922   Gene: ENSMICG00000006484   Transcript: ENSMICT00000006482
Sequence length 285
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1767:19997:43194:-1 gene:ENSMICG00000006484 transcript:ENSMICT00000006482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGSEPGFVGLSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXDMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQAPAPLPPRV
PELASAAPLPYAALEASGPPSVVPRRIPPPPPPVPAGRLATPFTAAMGSGQAMPYPGLQC
PPLPPRVGLPPQQGFSAQFVSPYPPALPQRPPPRLPPHQPGFILP
Download sequence
Identical sequences ENSMICP00000005922 ENSMICP00000005922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]