SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005952 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005952
Domain Number 1 Region: 21-112
Classification Level Classification E-value
Superfamily DNA clamp 0.0000135
Family DNA polymerase processivity factor 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005952   Gene: ENSMICG00000006513   Transcript: ENSMICT00000006513
Sequence length 280
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2877:241066:257678:-1 gene:ENSMICG00000006513 transcript:ENSMICT00000006513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKXXXXXXXXXXXXXXXXVSNMIAKLAKTCTLRISPDKLNFILSDKLANGGVSMWCELEQ
ENFFSEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELL
SVSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPHPDVSIYLPVLKTMKSVVEKMRNISNHL
VIEANLNGDLNLKIETELVCVTTHFKDLGNPPLASENASQDRNPEQMAEVHLDIRKLLQF
LVGQQVNPTKALCNIVSNKMVHFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences ENSMICP00000005952 ENSMICP00000005952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]