SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005979 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005979
Domain Number 1 Region: 320-629
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.44e-103
Family Aconitase iron-sulfur domain 0.0000000000231
Further Details:      
 
Domain Number 2 Region: 16-268
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 4.71e-91
Family Aconitase iron-sulfur domain 0.000000000318
Further Details:      
 
Domain Number 3 Region: 633-887
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.29e-83
Family LeuD-like 0.00000000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005979   Gene: ENSMICG00000006540   Transcript: ENSMICT00000006541
Sequence length 894
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1525:81525:117061:1 gene:ENSMICG00000006540 transcript:ENSMICT00000006541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPFIHLAEPLDPAQPGKKFFNLNKLGDSRYGRLPFSIRVLLEAAVRNCDEFLVKKNDV
ENILNWNVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPA
DLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQV
NLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLP
QVVGYMLMGKPHPLVTSTDIVLTITKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXLEQTGRDEKTVKHIKKYLQAMGMFRDFNDPSQDPDFAQIVE
LDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPDHHNDHKTFMYDNS
EFTLTHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVKPYIKTSLSPGSGVVTY
YLRESGVMPYLSKLGFDVVGYGCMTCIGNSGPLPEPVVDAIIQGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPSRDEIQAVE
RQYVIPGMFKEVYQKIETVNESWNALAVPSDKLYFWNPKSTYIKSPPFFENLTLDLQPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMA
RGTFANIRLLNKFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGSGSSR
DWAAKGPFLLGIKAILAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGQERYTVIIP
EDLRPRMKVQVKLDTGKAFQAVMRFDTDVELTYFRNGGILNYMIRKMAKASAPQ
Download sequence
Identical sequences ENSMICP00000005979 ENSMICP00000005979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]