SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006032 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006032
Domain Number 1 Region: 129-200
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000000000000418
Family RILP dimerisation region 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006032   Gene: ENSMICG00000006608   Transcript: ENSMICT00000006606
Sequence length 208
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1767:519540:579174:-1 gene:ENSMICG00000006608 transcript:ENSMICT00000006606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPRDDDEEEDDEERDEAGPEGALGKSPSRLTAEDVYDISFVVRELMALGSDPRVTQLQ
FKIVRVLEMLEALVSEGNLTAEALRMERDSLRKEVEGLRREGPPASREANLGPDKMVVDL
TDPNRPRFTLQELRDVLQERNRLKSQLLVAQEELQCYKXXXXXXXXXXXXXXXXXXXLVS
RAGRAGRDQGRRKTILKKLFFFRSGKHT
Download sequence
Identical sequences ENSMICP00000006032 ENSMICP00000006032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]