SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006187 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006187
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.00000000000213
Family Antibiotic resistance proteins 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006187   Gene: ENSMICG00000006791   Transcript: ENSMICT00000006787
Sequence length 92
Comment pep:known_by_projection scaffold:micMur1:scaffold_35275:4869:6264:1 gene:ENSMICG00000006791 transcript:ENSMICT00000006787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRKALCFGDQKFNLHEVGKEFEPKAAHTVPGSLDICLITEVPLEQMIQHLKACDVPIEEG
PVPRTGAKGPIMSIYFWDPDRNLIEVSNYMSS
Download sequence
Identical sequences ENSMICP00000006187 ENSMICP00000006187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]