SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006197 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000006197
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.00915
Family Molybdopterin synthase subunit MoaE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006197   Gene: ENSMICG00000006808   Transcript: ENSMICT00000006800
Sequence length 184
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2322:52414:52968:1 gene:ENSMICG00000006808 transcript:ENSMICT00000006800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI
KDLIKVAVKVAVLHRSGCFSPSELALATHFRDKLRQGAMTALSFGEVDFTFEAAVLAGKL
TECRDVLLKLVEHHLTPKSHGRIRHVFDHFSDPDLLTALYGPDFTQHRGKICDGLRKLLD
EGKL
Download sequence
Identical sequences ENSMICP00000006197 XP_012623010.1.48125 ENSMICP00000006197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]